Peptydy antydrobnoustrojowe

Z Wikipedii, wolnej encyklopedii
Przejdź do nawigacji Przejdź do wyszukiwania
Podstawy molekularne selektywności komórek peptydów antydrobnoustrojowych

Peptydy antydrobnoustrojowe (AMP, z ang. antimicrobial peptides), zwane również antybiotykami peptydowymi lub peptydami kationowymi – rodzaj peptydów, obejmujący wszystkie oligo- i polipeptydy, które zabijają drobnoustroje lub hamują ich wzrost, w tym peptydy, które powstały w wyniku oddzielenia się od większych białek, a także peptydy syntetyzowane nie rybosomalnie.

Mikroorganizm (gr. μικρός, mikrós – mały, ὀργανισμός, organismós – organizm), drobnoustrój, mikrob – organizm obserwowany dopiero pod mikroskopem. Pojęcie to nie jest zbyt precyzyjne, lecz z pewnością mikroorganizmami są bakterie, archeony, pierwotniaki i niektóre grzyby. Najprecyzyjniej grupa ta definiowana jest jako ogół organizmów jednokomórkowych, dlatego nie można terminu tego stosować do bardzo małych przedstawicieli różnych grup zwierząt, takich jak np. nicienie, wrotki, roztocza, niesporczaki, owady itd.PMID (ang. PubMed Identifier, PubMed Unique Identifier) – unikatowy identyfikator przypisany do każdego artykułu naukowego bazy PubMed.

Po raz pierwszy zostały opisane na początku lat osiemdziesiątych u zranionych żab i ropuch. Bezpośrednio po zranieniu, zaobserwowano u nich wydzielanie substancji zabijających drobnoustroje, które nazwano magaininami. Mechanizm działania polegał na przyłączaniu się cząsteczek magininy do drobnoustrojów i niszczeniu ich błon komórkowych. Późniejsze odkrycie pokrewieństwa pomiędzy magaininami a substancjami wykrytymi u innych gatunków (takimi jak cekropiny u ciem, tachyplezyny u krabów, tioniny u roślin oraz defensyny u ssaków) doprowadziło do wysunięcia hipotezy, że białka antydrobnoustrojowe należą do najstarszych mechanizmów obronnych organizmów wszystkich królestw zarówno roślin jak i zwierząt.

Polarność – właściwość indywiduów chemicznych polegająca na występowaniu w nich elektrycznego momentu dipolowego w wyniku nierównomiernego rozłożenia cząstkowych ładunków elektrycznych w ich objętości.Protegryny – peptydy antydrobnoustrojowe pochodzące z leukocytów wieprzowych, należące do rodziny katelicydyn. Są to kationowe, bogate w cysteinę białka zbudowane z 16-18 aminokwasów, zawierające dwa wiązania dwusiarczkowe, w roztworze przyjmujące strukturę β. Białkiem o najsilniejszych właściwościach przeciwbakteryjnych jest protegryna-1 (PG-1) hamująca rozwój zakażenia dwoinką Neisseria gonorrhoeae, Chlamydia trachomatis serowarem L2 oraz serowarami E i MoPn. Szczegółowe badania budowy i funkcji PG-1 wykazały, że amfipatyczna centralna β-płaszczyzna PG-1 jest niezbędna dla ich działania bakteriobójczego.

Klasyfikacja peptydów antydrobnoustrojowych[ | edytuj kod]

Klasyfikacja jest niezwykle trudna ze względu na różnorodność budowy. Obecnie przyjmowany podział wyróżnia:

  • peptydy z dominującą zawartością jednego lub kilku aminokwasów (często Pro, Trp, Arg, His),
  • peptydy ze strukturą przeważnie β-płaszczyznową i wewnątrzcząsteczkowym wiązaniem dwusiarczkowym (defensyny i protegryny)
  • α-helikalne peptydy o właściwościach amfipatycznych (magaininy, cekropiny).
  • Wyróżniono także inne klasy peptydów, mianowicie, peptydy o strukturze pętli z pojedynczym mostkiem dwusiarczkowym, fragmenty peptydów i peptydy anionowe, połączone czynnikami powierzchniowymi.

    Peptydy (gr. πεπτίδια, "strawne") – organiczne związki chemiczne, powstające przez połączenie cząsteczek aminokwasów wiązaniem peptydowym. Granica pomiędzy peptydem a białkiem nie jest dokładnie sprecyzowana, rozróżnienie jest oparte na masie cząsteczkowej klasyfikowanego związku. Za peptydy różni autorzy uważają poliaminokwasy o masie cząsteczkowej mniejszej od 5-10 tys. daltonów. Powyżej tej granicy związki takie zaliczamy do białek.Cekropiny – peptydy antydrobnoustrojowe po raz pierwszy opisane u ćmy Hyalophora cecropia. Peptydy te wyizolowano również od ssaków. Są to białka o ciężarze cząsteczkowym = 4203.4g/mol, zbudowane z 34-39 aminokwasów, posiadają dwie α-helisy. Wyróżniamy cekropiny: cekropinę A (KWKLFKKIEKVGQNIRDGIIIKAGPAVAVVGQATQIAK) i cekropinę B (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL), cekropinę P1 (wyizolowana z jelita świń). Cekropiny są aktywne wobec bakterii Gram-dodatnich i Gram-ujemnych. Zarówno cekropina A, jak i cekropina B wykazują właściwości cytolityczne w stosunku do kilku różnych linii komórek nowotworowych, przy czym nie powodują niszczenia prawidłowych komórek fibroblastów, limfocytów i erytrocytów. Suttman i wsp. wykazali, że cekropiny A i B wykazują dużą toksyczność względem komórek raka pęcherza moczowego z niewielkim efektem toksycznym w stosunku do komórek prawidłowych fibroblastów. Badania Madera wykazały, że skojarzenie cekropiny A z 5-fluorouracylem przynosi dodatkowy efekt cytotoksyczny przeciwko komórkom ostrej białaczki limfatycznej i może być zastosowana w terapii przeciwnowotworowej.

    Mechanizmy przenikania AMP przez błonę cytoplazmatyczną[ | edytuj kod]

    Peptydy antydrobnoustrojowe mogą przenikać przez błonę cytoplazmatyczną według różnych mechanizmów:

  • mechanizm klepek beczki – polega na kumulacji peptydów na kształt klepek beczki, gdzie niepolarne części wyścielają lipidy błony, a hydrofilowa wewnętrzna powierzchnia tworzy szczeliny
  • mechanizm łączących się kanałów, gdzie po połączeniu się z błoną AMP tworzą skupiska, a następnie wytwarzają szczeliny w błonie, wnikając do wnętrza komórki
  • mechanizm dywanowy, gdzie białka pokrywają szczelnie powierzchnię błony wywierając nacisk, czego efektem jest załamanie się konstrukcji błony
  • mechanizm robakowatego zagięcia błony zewnętrznej ściany komórkowej (hipotetyczny), gdzie powierzchnia błony zgina się charakterystycznie w tył za siebie, na kształt wnętrza wału formując tym samym szczelinę, co powoduje rozszerzenie się w regionie głównych grup dwuwarstwy lipidowej
  • Przypisy[ | edytuj kod]

    1. EA Porter, Wang, HS Lee, B Weisblum i inni. Non-haemolytic β-amino-acid oligomers. „Nature”. 404, s. 565, 6. DOI: 10.1038/35007145. PMID: 10766230. Sprawdź autora:2.
    2. M. Wu, E. Maier, R. Benz, RE. Hancock. Mechanism of interaction of different classes of cationic antimicrobial peptides with planar bilayers and with the cytoplasmic membrane of Escherichia coli. „Biochemistry”. 38 (22), s. 7235-7242, 1999. DOI: 10.1021/bi9826299. PMID: 10353835. 
    3. MW. Maddox, ML. Longo. A Monte Carlo study of peptide insertion into lipid bilayers: Equilibrium conformations and insertion mechanisms. „Biophys J”. 82 (1 Pt 1), s. 244-263, 2002. DOI: 10.1016/S0006-3495(02)75391-5. PMID: 11751313. 
    4. SJ. Ludtke, K. He, WT. Heller, TA. Harroun i inni. Membrane pores induced by magainin. „Biochemistry”. 35 (43), s. 13723-8, 1996. DOI: 10.1021/bi9620621. PMID: 8901513. 
    Białka – wielkocząsteczkowe (masa cząsteczkowa od ok. 10 000 do kilku mln Daltonów) biopolimery, a właściwie biologiczne polikondensaty, zbudowane z reszt aminokwasów połączonych ze sobą wiązaniami peptydowymi -CONH-. Występują we wszystkich żywych organizmach oraz wirusach. Synteza białek odbywa się przy udziale specjalnych organelli komórkowych zwanych rybosomami.DOI (ang. digital object identifier – cyfrowy identyfikator dokumentu elektronicznego) – identyfikator dokumentu elektronicznego, który w odróżnieniu od identyfikatorów URL nie zależy od fizycznej lokalizacji dokumentu, lecz jest do niego na stałe przypisany.




    Warto wiedzieć że... beta

    Aminokwasy – organiczne związki chemiczne zawierające zasadową grupę aminową -NH2 oraz kwasową grupę karboksylową -COOH lub – w ujęciu ogólniejszym – dowolną grupę kwasową, np. sulfonową -SO3H. Aminokwasy są tzw. solami wewnętrznymi (amfolitami).
    Defensyny (defenzyny) – grupa małych (15-20 aminokwasów), bogatych w cysteinę białek kationowych występujących w komórkach żernych kręgowców (szczególnie w ziarnistościach azurofilnych neutrofili), aktywnych wobec bakterii, grzybów i wirusów osłonkowych .

    Reklama